PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi09g08770.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family SBP
Protein Properties Length: 278aa    MW: 31195.8 Da    PI: 7.7093
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi09g08770.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.56.1e-41164241178
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      +Cqve+C+adls+ak+yhrrhkvC++hska+++lv +++qrfCqqCsrfh l+efDe+krsCrr La+hn+rrrk+++
  Vradi09g08770.1 164 VCQVEDCRADLSNAKDYHRRHKVCDMHSKASKALVGNVMQRFCQQCSRFHVLQEFDEGKRSCRRXLAGHNKRRRKTHP 241
                      6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.3E-33161226IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.607162239IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.84E-38163243IPR004333Transcription factor, SBP-box
PfamPF031101.7E-29165238IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MEAQLEGKNQ YLYGPVVPEM KSVGKRSLEW DLNDWKWDGD LFTATQLNSV PSDCTSRQLF  60
PADPEILAAG DASNSLSSSY DDVNLVEGRR ELEKRRRGVA DEPNGNNQDW RYCYVSTPIG  120
GVEMNDGAGS LNLNLGVQVY PIIEGEEKSG KKTKITGSTL NRAVCQVEDC RADLSNAKDY  180
HRRHKVCDMH SKASKALVGN VMQRFCQQCS RFHVLQEFDE GKRSCRRXLA GHNKRRRKTH  240
PDASVVNDGS VNEEKGSSYL LMSLLRILSN MHREFVC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-311642381084squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1233239KRRRKTH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150351e-151AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014501154.11e-175PREDICTED: squamosa promoter-binding-like protein 1 isoform X1
RefseqXP_014501155.11e-175PREDICTED: squamosa promoter-binding-like protein 1 isoform X2
SwissprotQ9SMX96e-66SPL1_ARATH; Squamosa promoter-binding-like protein 1
TrEMBLA0A0L9T6P91e-178A0A0L9T6P9_PHAAN; Uncharacterized protein
STRINGGLYMA15G21860.11e-158(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15393495
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.12e-63squamosa promoter binding protein-like 1